Recombinant Mouse Ubiquitin-protein ligase E3A (Ube3a), partial
Catalog Number:
CSB-YP025488MO
- Images (0)
| Article Name: | Recombinant Mouse Ubiquitin-protein ligase E3A (Ube3a), partial |
| Biozol Catalog Number: | CSB-YP025488MO |
| Supplier Catalog Number: | CSB-YP025488MO |
| Alternative Catalog Number: | CSB-YP025488MO-1, CSB-YP025488MO-100, CSB-YP025488MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Oncogenic protein-associated protein E6-AP,CSB-PR2024 |
| Molecular Weight: | 39.9 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | O08759 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 542-870aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | NPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDE |
Product Guarantee and Expert Support
