Recombinant Human Nucleolar transcription factor 1 (UBTF), partial
Catalog Number:
CSB-YP025524HU1
- Images (0)
| Article Name: | Recombinant Human Nucleolar transcription factor 1 (UBTF), partial |
| Biozol Catalog Number: | CSB-YP025524HU1 |
| Supplier Catalog Number: | CSB-YP025524HU1 |
| Alternative Catalog Number: | CSB-YP025524HU1-1, CSB-YP025524HU1-100, CSB-YP025524HU1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Autoantigen NOR-90)(Upstream-binding factor 1)(UBF-1) |
| Molecular Weight: | 80.8 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | P17480 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-670aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRK |
Product Guarantee and Expert Support
