Recombinant Mouse Uromodulin (Umod), partial
Catalog Number:
CSB-YP025616MO
- Images (0)
| Article Name: | Recombinant Mouse Uromodulin (Umod), partial |
| Biozol Catalog Number: | CSB-YP025616MO |
| Supplier Catalog Number: | CSB-YP025616MO |
| Alternative Catalog Number: | CSB-YP025616MO-1, CSB-YP025616MO-100, CSB-YP025616MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Tamm-Horsfall urinary glycoprotein Short name: THP Cleaved into the following chain: Uromodulin, secreted form |
| Molecular Weight: | 64.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q91X17 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 25-588aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | NSTEARRCSECHNNATCTVDGVVTTCSCQTGFTGDGLVCEDMDECATPWTHNCSNSSCVNTPGSFKCSCQDGFRLTPELSCTDVDECSEQGLSNCHALATCVNTEGDYLCVCPEGFTGDGWYCECSPGSCEPGLDCLPQGPDGKLVCQDPCNTYETLTEYWRSTEYGVGYSCDAGLHGWYRFTGQGGVRMAETCVPVLRCNTAAPMWLNGSHPSSSEGIVSRTACAHWSDQCCRWSTEIQVKACPGGFYIYNLT |
Product Guarantee and Expert Support
