Recombinant Mouse Vascular endothelial growth factor C (Vegfc)
Catalog Number:
CSB-YP025835MO
- Images (0)
| Article Name: | Recombinant Mouse Vascular endothelial growth factor C (Vegfc) |
| Biozol Catalog Number: | CSB-YP025835MO |
| Supplier Catalog Number: | CSB-YP025835MO |
| Alternative Catalog Number: | CSB-YP025835MO-1, CSB-YP025835MO-100, CSB-YP025835MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Flt4 ligand ,Flt4-LVascular endothelial growth factor-related protein ,VRP |
| Molecular Weight: | 15 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P97953 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 108-223aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR |
Product Guarantee and Expert Support
