Recombinant Mouse Y-box-binding protein 1 (Ybx1)
Catalog Number:
CSB-YP026247MO
- Images (0)
| Article Name: | Recombinant Mouse Y-box-binding protein 1 (Ybx1) |
| Biozol Catalog Number: | CSB-YP026247MO |
| Supplier Catalog Number: | CSB-YP026247MO |
| Alternative Catalog Number: | CSB-YP026247MO-1, CSB-YP026247MO-100, CSB-YP026247MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | CCAAT-binding transcription factor I subunit A ,CBF-ADNA-binding protein B ,DBPBEnhancer factor I subunit A ,EFI-AY-box transcription factorY-box-binding protein 1 ,YB-1 |
| Molecular Weight: | 37.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P62960 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 2-322aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYARRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPRE |
Product Guarantee and Expert Support
