Recombinant Human YjeF N-terminal domain-containing protein 3 (YJEFN3)
Catalog Number:
CSB-YP026264HU
- Images (0)
| Article Name: | Recombinant Human YjeF N-terminal domain-containing protein 3 (YJEFN3) |
| Biozol Catalog Number: | CSB-YP026264HU |
| Supplier Catalog Number: | CSB-YP026264HU |
| Alternative Catalog Number: | CSB-YP026264HU-1, CSB-YP026264HU-100, CSB-YP026264HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | YjeF_N3 (hYjeF_N3),CSB-PR2024 |
| Molecular Weight: | 33.2 kDa |
| Tag: | Tag-Free |
| UniProt: | A6XGL0 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-299aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQSTAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLA |
Product Guarantee and Expert Support
