Recombinant Burkholderia thailandensis Type III secretion system needle protein (yscF)
Catalog Number:
CSB-YP2103BNU
- Images (0)
| Article Name: | Recombinant Burkholderia thailandensis Type III secretion system needle protein (yscF) |
| Biozol Catalog Number: | CSB-YP2103BNU |
| Supplier Catalog Number: | CSB-YP2103BNU |
| Alternative Catalog Number: | CSB-YP2103BNU-1, CSB-YP2103BNU-100, CSB-YP2103BNU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | /,CSB-PR2024 |
| Molecular Weight: | 11.4kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q2T727 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-89aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSNPPTPLLTDYEWSGYLTGIGRAFDTGVKDLNQQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR |
Product Guarantee and Expert Support
