Recombinant Macaca mulatta Oncostatin M (OSM), partial
Catalog Number:
CSB-YP2949MOW
- Images (0)
| Article Name: | Recombinant Macaca mulatta Oncostatin M (OSM), partial |
| Biozol Catalog Number: | CSB-YP2949MOW |
| Supplier Catalog Number: | CSB-YP2949MOW |
| Alternative Catalog Number: | CSB-YP2949MOW-1, CSB-YP2949MOW-100, CSB-YP2949MOW-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | / |
| Molecular Weight: | 27.0 kDa |
| Tag: | Tag-Free |
| UniProt: | F7GF43 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 22-252aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR |
Product Guarantee and Expert Support
