Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731)
Catalog Number:
CSB-YP300323MVZ
- Images (0)
| Article Name: | Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731) |
| Biozol Catalog Number: | CSB-YP300323MVZ |
| Supplier Catalog Number: | CSB-YP300323MVZ |
| Alternative Catalog Number: | CSB-YP300323MVZ-1, CSB-YP300323MVZ-100, CSB-YP300323MVZ-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | MT2731, Antitoxin MT2731 |
| Molecular Weight: | 9.7 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P9WJ10 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-81aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP |
Product Guarantee and Expert Support
