Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB)
Catalog Number:
CSB-YP300809EKZ
- Images (0)
| Article Name: | Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) |
| Biozol Catalog Number: | CSB-YP300809EKZ |
| Supplier Catalog Number: | CSB-YP300809EKZ |
| Alternative Catalog Number: | CSB-YP300809EKZ-1, CSB-YP300809EKZ-100, CSB-YP300809EKZ-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Verocytotoxin 1 subunit B ,Verotoxin 1 subunit B,CSB-PR2024 |
| Molecular Weight: | 9.7 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P69179 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 21-89aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR |
Product Guarantee and Expert Support
