Recombinant Macaca fascicularis Interleukin-4 (IL4)

Catalog Number: CSB-YP301281MOV
Article Name: Recombinant Macaca fascicularis Interleukin-4 (IL4)
Biozol Catalog Number: CSB-YP301281MOV
Supplier Catalog Number: CSB-YP301281MOV
Alternative Catalog Number: CSB-YP301281MOV-1, CSB-YP301281MOV-100, CSB-YP301281MOV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: B-cell stimulatory factor 1
Molecular Weight: 16.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P79339
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 25-153aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS