Recombinant Alternaria alternata Heat shock 70KDA protein (HSP70)

Catalog Number: CSB-YP302100AZV
Article Name: Recombinant Alternaria alternata Heat shock 70KDA protein (HSP70)
Biozol Catalog Number: CSB-YP302100AZV
Supplier Catalog Number: CSB-YP302100AZV
Alternative Catalog Number: CSB-YP302100AZV-1, CSB-YP302100AZV-100, CSB-YP302100AZV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Allergen: Alt a 3
Molecular Weight: 18.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P78983
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-152aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD