Recombinant Alternaria alternata Major allergen Alt a 1 (ALTA1)
Catalog Number:
CSB-YP303588AZV
- Images (0)
| Article Name: | Recombinant Alternaria alternata Major allergen Alt a 1 (ALTA1) |
| Biozol Catalog Number: | CSB-YP303588AZV |
| Supplier Catalog Number: | CSB-YP303588AZV |
| Alternative Catalog Number: | CSB-YP303588AZV-1, CSB-YP303588AZV-100, CSB-YP303588AZV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Allergen: Alt a 1 |
| Molecular Weight: | 17.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P79085 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 19-157aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS |
Product Guarantee and Expert Support
