Recombinant Juniperus ashei Pectate lyase 1
Catalog Number:
CSB-YP305864JAN
- Images (0)
| Article Name: | Recombinant Juniperus ashei Pectate lyase 1 |
| Biozol Catalog Number: | CSB-YP305864JAN |
| Supplier Catalog Number: | CSB-YP305864JAN |
| Alternative Catalog Number: | CSB-YP305864JAN-1, CSB-YP305864JAN-100, CSB-YP305864JAN-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | , Pectate lyase 1, EC 4.2.2.2, Major pollen allergen Jun a 1, allergen Jun a 1,CSB-PR2024 |
| Molecular Weight: | 39.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P81294 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 22-367aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIG |
Product Guarantee and Expert Support
