Recombinant Arabidopsis thaliana Putative defensin-like protein 70 (LCR83)
Catalog Number:
CSB-YP306814DOA
- Images (0)
| Article Name: | Recombinant Arabidopsis thaliana Putative defensin-like protein 70 (LCR83) |
| Biozol Catalog Number: | CSB-YP306814DOA |
| Supplier Catalog Number: | CSB-YP306814DOA |
| Alternative Catalog Number: | CSB-YP306814DOA-1, CSB-YP306814DOA-100, CSB-YP306814DOA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Putative low-molecular-weight cysteine-rich protein 83 Short name: Protein LCR83 |
| Molecular Weight: | 32.9 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P82792 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 28-82aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT |
Product Guarantee and Expert Support
