Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin
Catalog Number:
CSB-YP307648LKN
- Images (0)
| Article Name: | Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin |
| Biozol Catalog Number: | CSB-YP307648LKN |
| Supplier Catalog Number: | CSB-YP307648LKN |
| Alternative Catalog Number: | CSB-YP307648LKN-1, CSB-YP307648LKN-100, CSB-YP307648LKN-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Ribosome-inactivating protein lychnin, EC 3.2.2.22 |
| Molecular Weight: | 28.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P85101 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-234aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN |
Product Guarantee and Expert Support
