Recombinant Quercus alba Major pollen allergen Que a 1, partial
Catalog Number:
CSB-YP307655QAA
- Images (0)
| Article Name: | Recombinant Quercus alba Major pollen allergen Que a 1, partial |
| Biozol Catalog Number: | CSB-YP307655QAA |
| Supplier Catalog Number: | CSB-YP307655QAA |
| Alternative Catalog Number: | CSB-YP307655QAA-1, CSB-YP307655QAA-100, CSB-YP307655QAA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Major pollen allergen Que a 1(allergen Que a 1)(Fragment) |
| Molecular Weight: | 21.4 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P85126 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-50aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP |
Product Guarantee and Expert Support
