Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1)

Catalog Number: CSB-YP308545CZD
Article Name: Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1)
Biozol Catalog Number: CSB-YP308545CZD
Supplier Catalog Number: CSB-YP308545CZD
Alternative Catalog Number: CSB-YP308545CZD-1, CSB-YP308545CZD-100, CSB-YP308545CZD-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: 58 kDa fibrinogen-binding mannoprotein FBP1
Molecular Weight: 33.4 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P87020
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 16-299aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTAS