Recombinant Avena sativa Endochitinase, partial
Catalog Number:
CSB-YP308852DPO
- Images (0)
| Article Name: | Recombinant Avena sativa Endochitinase, partial |
| Biozol Catalog Number: | CSB-YP308852DPO |
| Supplier Catalog Number: | CSB-YP308852DPO |
| Alternative Catalog Number: | CSB-YP308852DPO-1, CSB-YP308852DPO-100, CSB-YP308852DPO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Endochitinase, EC 3.2.1.14, Fragments |
| Molecular Weight: | 25.2 kDa |
| Tag: | N-terminal 6xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P86181 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-200aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA |
Product Guarantee and Expert Support
