Recombinant Hepatitis C virus genotype 1b Genome polyprotein, partial
Catalog Number:
CSB-YP530838HVQ(A4)
- Images (0)
| Article Name: | Recombinant Hepatitis C virus genotype 1b Genome polyprotein, partial |
| Biozol Catalog Number: | CSB-YP530838HVQ(A4) |
| Supplier Catalog Number: | CSB-YP530838HVQ(A4) |
| Alternative Catalog Number: | CSB-YP530838HVQ(A4)-1, CSB-YP530838HVQ(A4)-100, CSB-YP530838HVQ(A4)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Genome polyprotein [Cleaved into: Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC |
| Molecular Weight: | 20.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | O92972 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 192-358aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | YEVRNVSGIYHVTNDCSNSSIVYEAADVIMHTPGCVPCVREGNSSRCWVALTPTLAARNASVPTTTIRRHVDLLVGTAAFCSAMYVGDLCGSIFLVSQLFTFSPRRHETVQDCNCSIYPGHVSGHRMAWDMMMNWSPTTALVVSQLLRIPQAVVDMVAGAHWGVLAG |
Product Guarantee and Expert Support
