Recombinant Mouse Interferon epsilon (Ifne)

Catalog Number: CSB-YP800374MO
Article Name: Recombinant Mouse Interferon epsilon (Ifne)
Biozol Catalog Number: CSB-YP800374MO
Supplier Catalog Number: CSB-YP800374MO
Alternative Catalog Number: CSB-YP800374MO-1, CSB-YP800374MO-100, CSB-YP800374MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Interferon epsilon-1Interferon tau-1
Molecular Weight: 22 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q80ZF2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 22-192aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP