Recombinant Human m7GpppN-mRNA hydrolase (DCP2)
Catalog Number:
CSB-YP810265HU
- Images (0)
| Article Name: | Recombinant Human m7GpppN-mRNA hydrolase (DCP2) |
| Biozol Catalog Number: | CSB-YP810265HU |
| Supplier Catalog Number: | CSB-YP810265HU |
| Alternative Catalog Number: | CSB-YP810265HU-1, CSB-YP810265HU-100, CSB-YP810265HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Nucleoside diphosphate-linked moiety X motif 20 ,Nudix motif 20mRNA-decapping enzyme 2 ,hDpc |
| Molecular Weight: | 46.4 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8IU60 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-385aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFS |
Product Guarantee and Expert Support
