Recombinant Human mRNA-decapping enzyme 1B (DCP1B)

Catalog Number: CSB-YP811635HU
Article Name: Recombinant Human mRNA-decapping enzyme 1B (DCP1B)
Biozol Catalog Number: CSB-YP811635HU
Supplier Catalog Number: CSB-YP811635HU
Alternative Catalog Number: CSB-YP811635HU-1, CSB-YP811635HU-100, CSB-YP811635HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: DCP 1B, DCP1, DCP1 decapping enzyme homolog B, DCP1B, DCP1B_HUMAN, Decapping enzyme Dcp1b, Decapping enzyme hDcp1b, Decapping enzyme homolog B (S. cerevisiae), Decapping mRNA 1B, hDcp1b, mRNA decapping enzyme 1B, mRNA-decapping enzyme 1B
Molecular Weight: 69.6 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q8IZD4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 2-617aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLFVYTRSASPKHGFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAHQGTGAGISPVILNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPIPVKPSENQQQRIPQPNQTLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQ