Recombinant Mouse Alpha/beta hydrolase domain-containing protein 11 (Abhd11)
Catalog Number:
CSB-YP811717MO
- Images (0)
| Article Name: | Recombinant Mouse Alpha/beta hydrolase domain-containing protein 11 (Abhd11) |
| Biozol Catalog Number: | CSB-YP811717MO |
| Supplier Catalog Number: | CSB-YP811717MO |
| Alternative Catalog Number: | CSB-YP811717MO-1, CSB-YP811717MO-100, CSB-YP811717MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Williams-Beuren syndrome chromosomal region 21 protein homolog |
| Molecular Weight: | 35.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8K4F5 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-307aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLF |
Product Guarantee and Expert Support
