Recombinant Mouse Protein delta homolog 2 (Dlk2), partial
Catalog Number:
CSB-YP812967MO
- Images (0)
| Article Name: | Recombinant Mouse Protein delta homolog 2 (Dlk2), partial |
| Biozol Catalog Number: | CSB-YP812967MO |
| Supplier Catalog Number: | CSB-YP812967MO |
| Alternative Catalog Number: | CSB-YP812967MO-1, CSB-YP812967MO-100, CSB-YP812967MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Endothelial cell-specific protein S-1 Epidermal growth factor-like protein 9 Short name: EGF-like protein 9 |
| Molecular Weight: | 31.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8K1E3 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 27-305aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHS |
Product Guarantee and Expert Support
