Recombinant Vibrio vulnificus Fe/S biogenesis protein NfuA (nfuA)
Catalog Number:
CSB-YP813457VFI
- Images (0)
| Article Name: | Recombinant Vibrio vulnificus Fe/S biogenesis protein NfuA (nfuA) |
| Biozol Catalog Number: | CSB-YP813457VFI |
| Supplier Catalog Number: | CSB-YP813457VFI |
| Alternative Catalog Number: | CSB-YP813457VFI-1, CSB-YP813457VFI-100, CSB-YP813457VFI-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | nfuA, VV1_0864, Fe/S biogenesis protein NfuA |
| Molecular Weight: | 23 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8DDU2 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-194aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY |
Product Guarantee and Expert Support
