Recombinant Human CMRF35-like molecule 1 (CD300LF), partial
Catalog Number:
CSB-YP819470HU
- Images (0)
| Article Name: | Recombinant Human CMRF35-like molecule 1 (CD300LF), partial |
| Biozol Catalog Number: | CSB-YP819470HU |
| Supplier Catalog Number: | CSB-YP819470HU |
| Alternative Catalog Number: | CSB-YP819470HU-1, CSB-YP819470HU-100, CSB-YP819470HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | CD300 antigen-like family member FImmune receptor expressed on myeloid cells 1 ,IREM-1Immunoglobulin superfamily member 13 ,IgSF13NK inhibitory receptor, CD300f,CSB-PR2024 |
| Molecular Weight: | 17.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8TDQ1 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 20-156aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS |
Product Guarantee and Expert Support
