Recombinant Salmonella typhi Universal stress protein A (uspA)
Catalog Number:
CSB-YP820596SWW
- Images (0)
| Article Name: | Recombinant Salmonella typhi Universal stress protein A (uspA) |
| Biozol Catalog Number: | CSB-YP820596SWW |
| Supplier Catalog Number: | CSB-YP820596SWW |
| Alternative Catalog Number: | CSB-YP820596SWW-1, CSB-YP820596SWW-100, CSB-YP820596SWW-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | uspA, STY4212, t3925, Universal stress protein A |
| Molecular Weight: | 17.9 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8Z268 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 2-144aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE |
Product Guarantee and Expert Support
