Recombinant Mouse Serine protease inhibitor A3N (Serpina3n)
Catalog Number:
CSB-YP835578MOB0
- Images (0)
| Article Name: | Recombinant Mouse Serine protease inhibitor A3N (Serpina3n) |
| Biozol Catalog Number: | CSB-YP835578MOB0 |
| Supplier Catalog Number: | CSB-YP835578MOb0 |
| Alternative Catalog Number: | CSB-YP835578MOB0-1, CSB-YP835578MOB0-100, CSB-YP835578MOB0-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Spi2,CSB-PR2024 |
| Molecular Weight: | 47.3 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q91WP6 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 21-418aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALF |
Product Guarantee and Expert Support
