Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD)
Catalog Number:
CSB-YP836318APOA4
- Images (0)
| Article Name: | Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD) |
| Biozol Catalog Number: | CSB-YP836318APOA4 |
| Supplier Catalog Number: | CSB-YP836318APOa4 |
| Alternative Catalog Number: | CSB-YP836318APOA4-1, CSB-YP836318APOA4-100, CSB-YP836318APOA4-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Carboxymethylcellulase D Cellulase 61A Cellulase D cel61A,CSB-PR2024 |
| Molecular Weight: | 55.7 kDa |
| Tag: | N-terminal 6xHis-sumostar-tagged |
| UniProt: | Q96WQ9 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 21-408aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAA |
Product Guarantee and Expert Support
