Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8), partial
Catalog Number:
CSB-YP836734HU
- Images (0)
| Article Name: | Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8), partial |
| Biozol Catalog Number: | CSB-YP836734HU |
| Supplier Catalog Number: | CSB-YP836734HU |
| Alternative Catalog Number: | CSB-YP836734HU-1, CSB-YP836734HU-100, CSB-YP836734HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | DOCK8Dedicator of cytokinesis protein 8 |
| Molecular Weight: | 21.3 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8NF50 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 560-729aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV |
Product Guarantee and Expert Support
