Recombinant Human BPI fold-containing family A member 2 (BPIFA2)
Catalog Number:
CSB-YP839308HU
- Images (0)
| Article Name: | Recombinant Human BPI fold-containing family A member 2 (BPIFA2) |
| Biozol Catalog Number: | CSB-YP839308HU |
| Supplier Catalog Number: | CSB-YP839308HU |
| Alternative Catalog Number: | CSB-YP839308HU-1, CSB-YP839308HU-100, CSB-YP839308HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Parotid secretory protein,CSB-PR2024 |
| Molecular Weight: | 41.1 kDa |
| Tag: | N-terminal 6xHis-sumostar-tagged |
| UniProt: | Q96DR5 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 19-249aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI |
Product Guarantee and Expert Support
