Recombinant Bovine C-C motif chemokine 20 (CCL20)
Catalog Number:
CSB-YP840478BO
- Images (0)
| Article Name: | Recombinant Bovine C-C motif chemokine 20 (CCL20) |
| Biozol Catalog Number: | CSB-YP840478BO |
| Supplier Catalog Number: | CSB-YP840478BO |
| Alternative Catalog Number: | CSB-YP840478BO-1, CSB-YP840478BO-100, CSB-YP840478BO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Macrophage inflammatory protein 3 alpha Short name: MIP-3-alpha Small-inducible cytokine A20 |
| Molecular Weight: | 10.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8SQB1 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 27-96aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM |
Product Guarantee and Expert Support
