Recombinant Salmonella typhi LPS-assembly protein LptD (lptD), partial
Catalog Number:
CSB-YP845655SWW
- Images (0)
| Article Name: | Recombinant Salmonella typhi LPS-assembly protein LptD (lptD), partial |
| Biozol Catalog Number: | CSB-YP845655SWW |
| Supplier Catalog Number: | CSB-YP845655SWW |
| Alternative Catalog Number: | CSB-YP845655SWW-1, CSB-YP845655SWW-100, CSB-YP845655SWW-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | lptD, imp, ostA, STY0108, t0096LPS-assembly protein LptD |
| Molecular Weight: | 12.9 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8Z9J6 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 73-169aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS |
Product Guarantee and Expert Support
