Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)
Catalog Number:
CSB-YP848660BJN
- Images (0)
| Article Name: | Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) |
| Biozol Catalog Number: | CSB-YP848660BJN |
| Supplier Catalog Number: | CSB-YP848660BJN |
| Alternative Catalog Number: | CSB-YP848660BJN-1, CSB-YP848660BJN-100, CSB-YP848660BJN-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ns4.8,4.8 kDa accessory protein |
| Molecular Weight: | 6.4 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q8V6W4 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-45aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MPMATTIDGTDYTNIMPSTVSTRVYLGCSIGIDTSTTGFTCFSWY |
Product Guarantee and Expert Support
