Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain (CD3G), partial
Catalog Number:
CSB-YP850179MOV
- Images (0)
| Article Name: | Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain (CD3G), partial |
| Biozol Catalog Number: | CSB-YP850179MOV |
| Supplier Catalog Number: | CSB-YP850179MOV |
| Alternative Catalog Number: | CSB-YP850179MOV-1, CSB-YP850179MOV-100, CSB-YP850179MOV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | T-cell receptor T3 gamma chain CD_antigen: CD3g,CSB-PR2024 |
| Molecular Weight: | 12.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q95LI7 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 23-113aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT |
Product Guarantee and Expert Support
