Recombinant Mouse Alanine aminotransferase 1 (Gpt)
Catalog Number:
CSB-YP851235MO
- Images (0)
| Article Name: | Recombinant Mouse Alanine aminotransferase 1 (Gpt) |
| Biozol Catalog Number: | CSB-YP851235MO |
| Supplier Catalog Number: | CSB-YP851235MO |
| Alternative Catalog Number: | CSB-YP851235MO-1, CSB-YP851235MO-100, CSB-YP851235MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ALT1 Alternative name(s): Glutamate pyruvate transaminase 1 Short name: GPT 1 Glutamic--alanine transaminase 1 Glutamic--pyruvic transaminase 1 |
| Molecular Weight: | 57 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8QZR5 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 2-496aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ASQRNDRIQASRNGLKGKVLTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLLVAGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECI |
Product Guarantee and Expert Support
