Recombinant Human SH3 domain-containing YSC84-like protein 1 (SH3YL1)
Catalog Number:
CSB-YP853429HU
- Images (0)
| Article Name: | Recombinant Human SH3 domain-containing YSC84-like protein 1 (SH3YL1) |
| Biozol Catalog Number: | CSB-YP853429HU |
| Supplier Catalog Number: | CSB-YP853429HU |
| Alternative Catalog Number: | CSB-YP853429HU-1, CSB-YP853429HU-100, CSB-YP853429HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | DKFZP586F1318, RAY, SH3 domain containing, Ysc84-like 1 (S. cerevisiae), SH3 domain-containing YSC84-like protein 1, SH3Y1_HUMAN, Sh3yl1,CSB-PR2024 |
| Molecular Weight: | 40.6 kDa |
| Tag: | N-terminal 6xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q96HL8 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-342aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVVARLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNLTLGGNLTVAVGPLGRNLEGNVALRSSAAVFTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEGQRINARKAAREQRKSSAKELPPKPLSRPQQSSAPVQ |
Product Guarantee and Expert Support
