Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn)
Catalog Number:
CSB-YP858805SKY
- Images (0)
| Article Name: | Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn) |
| Biozol Catalog Number: | CSB-YP858805SKY |
| Supplier Catalog Number: | CSB-YP858805SKY |
| Alternative Catalog Number: | CSB-YP858805SKY-1, CSB-YP858805SKY-100, CSB-YP858805SKY-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | scn, SA1754, Staphylococcal complement inhibitor, SCIN |
| Molecular Weight: | 12.3 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q99SU9 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 32-116aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY |
Product Guarantee and Expert Support
