Recombinant Mouse Heat shock protein 75 kDa, mitochondrial (Trap1)
Catalog Number:
CSB-YP863423MO
- Images (0)
| Article Name: | Recombinant Mouse Heat shock protein 75 kDa, mitochondrial (Trap1) |
| Biozol Catalog Number: | CSB-YP863423MO |
| Supplier Catalog Number: | CSB-YP863423MO |
| Alternative Catalog Number: | CSB-YP863423MO-1, CSB-YP863423MO-100, CSB-YP863423MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (HSP 75)(TNFR-associated protein 1)(Tumor necrosis factor type 1 receptor-associated protein)(TRAP-1) |
| Molecular Weight: | 74.7 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q9CQN1 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 61-706aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | STQAAEDKEEESLHSIISNTEAVRGSVSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVCEGQVLPEMEIHLQTDAKKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLEALQNQAETSSKIIGQFGVGFYSAFMVADKVEVYSRSAAPESPGYQWLSDGSGVFEIAEASGVRPGTKIIIHLKSDCKDFASESRVQDVVTKYSNFVSFPLYLNGKRINTLQAIWMMDPKDISEFQHE |
Product Guarantee and Expert Support
