Recombinant Mouse BAG family molecular chaperone regulator 3 (Bag3)

Catalog Number: CSB-YP864372MO
Article Name: Recombinant Mouse BAG family molecular chaperone regulator 3 (Bag3)
Biozol Catalog Number: CSB-YP864372MO
Supplier Catalog Number: CSB-YP864372MO
Alternative Catalog Number: CSB-YP864372MO-1, CSB-YP864372MO-100, CSB-YP864372MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Bcl-2-associated athanogene 3Bcl-2-binding protein Bis
Molecular Weight: 63.7 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q9JLV1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 2-577aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SAATQSPMMQMASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKDTASSANGPSRDGSRLLPIREGHPIYPQLRPGYIPIPVLHEGSENRQPHLFHAYSQPGVQRFRTEAAAATPQRSQSPLRGGMTEAAQTDKQCGQMPATATTAAAQPPTAHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRPAAQPSFHQAQKTHYPAQQGEYQPQQPVYHK