Recombinant Rat Vesicular glutamate transporter 2 (Slc17a6), partial
Catalog Number:
CSB-YP867480RA
- Images (0)
| Article Name: | Recombinant Rat Vesicular glutamate transporter 2 (Slc17a6), partial |
| Biozol Catalog Number: | CSB-YP867480RA |
| Supplier Catalog Number: | CSB-YP867480RA |
| Alternative Catalog Number: | CSB-YP867480RA-1, CSB-YP867480RA-100, CSB-YP867480RA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (VGluT2)(Differentiation-associated BNPI)(Differentiation-associated Na(+)(Solute carrier family 17 member 6),CSB-PR2024 |
| Molecular Weight: | 11.1 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q9JI12 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 499-582aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS |
Product Guarantee and Expert Support
