Recombinant Arabidopsis thaliana UDP-glycosyltransferase 78D1 (UGT78D1)
Catalog Number:
CSB-YP871008DOA
- Images (0)
| Article Name: | Recombinant Arabidopsis thaliana UDP-glycosyltransferase 78D1 (UGT78D1) |
| Biozol Catalog Number: | CSB-YP871008DOA |
| Supplier Catalog Number: | CSB-YP871008DOA |
| Alternative Catalog Number: | CSB-YP871008DOA-1, CSB-YP871008DOA-100, CSB-YP871008DOA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Flavonol-3-O-glucoside L-rhamnosyltransferase (UDP-rhamnose:flavonol 3-O-glucoside rhamnosyltransferase) |
| Molecular Weight: | 52.6 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q9S9P6 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-453aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MTKFSEPIRDSHVAVLAFFPVGAHAGPLLAVTRRLAAASPSTIFSFFNTARSNASLFSSDHPENIKVHDVSDGVPEGTMLGNPLEMVELFLEAAPRIFRSEIAAAEIEVGKKVTCMLTDAFFWFAADIAAELNATWVAFWAGGANSLCAHLYTDLIRETIGLKDVSMEETLGFIPGMENYRVKDIPEEVVFEDLDSVFPKALYQMSLALPRASAVFISSFEELEPTLNYNLRSKLKRFLNIAPLTLLSSTSEKE |
Product Guarantee and Expert Support
