Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
Catalog Number:
CSB-YP872766CBG
- Images (0)
| Article Name: | Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta |
| Biozol Catalog Number: | CSB-YP872766CBG |
| Supplier Catalog Number: | CSB-YP872766CBG |
| Alternative Catalog Number: | CSB-YP872766CBG-1, CSB-YP872766CBG-100, CSB-YP872766CBG-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Aggretin beta chain Rhodoaggretin subunit beta |
| Molecular Weight: | 16.4 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9I840 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 24-146aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA |
Product Guarantee and Expert Support
