Recombinant Human YTH domain-containing family protein 1 (YTHDF1)
Catalog Number:
CSB-YP874843HU
- Images (0)
| Article Name: | Recombinant Human YTH domain-containing family protein 1 (YTHDF1) |
| Biozol Catalog Number: | CSB-YP874843HU |
| Supplier Catalog Number: | CSB-YP874843HU |
| Alternative Catalog Number: | CSB-YP874843HU-1, CSB-YP874843HU-100, CSB-YP874843HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Dermatomyositis associated with cancer putative autoantigen 1 (DACA-1),CSB-PR2024 |
| Molecular Weight: | 62.8 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9BYJ9 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 2-559aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPV |
Product Guarantee and Expert Support
