Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1),partial

Product Overview

• Article Name: Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1),partial
• Biozol Catalog Number: CSB-YP878501DOA
• Supplier Catalog Number: CSB-YP878501DOA
• Alternative Catalog Number: CSB-YP878501DOA-1, CSB-YP878501DOA-100, CSB-YP878501DOA-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: 1,4-alpha-D-glucan maltohydrolase () () () () () () () Beta-amylase 7 Thioredoxin-regulated beta-amylase Short name: TR-BAMY BMY7, TRBAMY

Product Properties

• Molecular Weight: 36.3 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9LIR6
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Expression System: 42-354aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFP