Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9 (EPFL9)
Catalog Number:
CSB-YP879855DOA
- Images (0)
| Article Name: | Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9 (EPFL9) |
| Biozol Catalog Number: | CSB-YP879855DOA |
| Supplier Catalog Number: | CSB-YP879855DOA |
| Alternative Catalog Number: | CSB-YP879855DOA-1, CSB-YP879855DOA-100, CSB-YP879855DOA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | EPF-like protein 9 |
| Molecular Weight: | 10.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9SV72 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 32-102aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR |
Product Guarantee and Expert Support
