Recombinant Mouse Methyltransferase-like protein 10 (Mettl10)
Catalog Number:
CSB-YP880522MO
- Images (0)
| Article Name: | Recombinant Mouse Methyltransferase-like protein 10 (Mettl10) |
| Biozol Catalog Number: | CSB-YP880522MO |
| Supplier Catalog Number: | CSB-YP880522MO |
| Alternative Catalog Number: | CSB-YP880522MO-1, CSB-YP880522MO-100, CSB-YP880522MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Methyltransferase-like protein 10,Protein-lysine N-methyltransferase Mettl10 |
| Molecular Weight: | 30.3 kDa |
| Tag: | C-terminal 6xHis-Myc-tagged |
| UniProt: | Q9D853 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-244aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTKLSGFHVCVDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSFGGRSGNTVAALVFQKRGTSLDKIS |
Product Guarantee and Expert Support
