Recombinant Human Cell growth-regulating nucleolar protein (LYAR)
Catalog Number:
CSB-YP882130HU
- Images (0)
| Article Name: | Recombinant Human Cell growth-regulating nucleolar protein (LYAR) |
| Biozol Catalog Number: | CSB-YP882130HU |
| Supplier Catalog Number: | CSB-YP882130HU |
| Alternative Catalog Number: | CSB-YP882130HU-1, CSB-YP882130HU-100, CSB-YP882130HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Cell growth regulating nucleolar protein, Cell growth-regulating nucleolar protein, Likely ortholog of mouse Ly1 reactive clone , Ly1 reactive, Ly1 reactive homolog (mouse) , Ly1 reactive homolog, LYAR, LYAR_HUMAN, ZC2HC2, ZLYAR |
| Molecular Weight: | 45.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9NX58 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-379aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKKGQEADLEAGGEEVPEANGSAGKRSKKKKQ |
Product Guarantee and Expert Support
