Recombinant Human Delta-like protein 3 (DLL3), partial

Catalog Number: CSB-YP882142HU
Article Name: Recombinant Human Delta-like protein 3 (DLL3), partial
Biozol Catalog Number: CSB-YP882142HU
Supplier Catalog Number: CSB-YP882142HU
Alternative Catalog Number: CSB-YP882142HU-1, CSB-YP882142HU-100, CSB-YP882142HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Drosophila Delta homolog 3 ,Delta3
Molecular Weight: 50.5 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q9NYJ7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 27-492aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDG